| Desktop | 0/100 | ✘ |
| Mobile | 0/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 68 KB | ✔ |
| Compression | 11 KB (-83.3%) | ✔ |
| Text/Html Ratio | 3893 / 69176 (bytes) = 5.63% | ❗ |
| Load Time | 0.75 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 92 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | Spanish | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | No | ✘ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 5 / 8 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | Yes | ✔ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| para | 12 | ✔ | ✔ | ✘ |
| ciencias | 6 | ✘ | ✘ | ✘ |
| dejarun | 4 | ✘ | ✘ | ✘ |
| aprender | 4 | ✘ | ✘ | ✘ |
| nombre | 3 | ✘ | ✘ | ✘ |
| educación | 3 | ✘ | ✘ | ✘ |
| literatura | 3 | ✘ | ✘ | ✘ |
| plástica | 3 | ✘ | ✘ | ✘ |
| niños | 3 | ✘ | ✘ | ✘ |
| entre | 3 | ✘ | ✘ | ✘ |
| importante | 2 | ✘ | ✘ | ✘ |
| actividades | 2 | ✔ | ✘ | ✘ |
| infantil | 2 | ✔ | ✔ | ✘ |
| profesores | 2 | ✘ | ✘ | ✘ |
| escribir | 2 | ✘ | ✘ | ✘ |
|
With 0.75 seconds in page load, 68 KB of page size and all other reports below, the actividadesdeinfantilyprimaria.com has a SEO score of 66 out of 100 |
| Title | Actividades de infantil y primaria – Recursos para trabajar en infantil y primaria |
| Description | Recursos para trabajar en infantil y primaria |
| Keyword |
| Age | 7 Years, 156 Days |
| Created | 19th-Mar-2015 |
| Updated | 4th-Mar-2022 |
| Expiry | 19th-Mar-2023 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| actividadesdeinfantilyprimaria.com | A | 52 | ip:178.33.117.75 |
| actividadesdeinfantilyprimaria.com | NS | 60 | target:ns4.dondominio.com |
| actividadesdeinfantilyprimaria.com | NS | 60 | target:ns2.dondominio.com |
| actividadesdeinfantilyprimaria.com | SOA | 60 | mname:ns4.dondominio.comrname:dnsadmin.dondominio.comserial:2021112602refresh:10800retry:1800expire:691200minimum-ttl:3600 |
|
Access denied |
| Server IP | 164.132.249.200 |
| Server Location | Spain |
| Service Provider | OVH SAS |
| Domains (TLD) | Status |
|---|---|
| actividadesdeinfantilyprimaria.net | Available |
| actividadesdeinfantilyprimaria.org | Already Registered |
| actividadesdeinfantilyprimaria.biz | Already Registered |
| actividadesdeinfantilyprimaria.io | Already Registered |
| actividadesdeinfantilyprimaria.info | Already Registered |
| Domains (TLD) | Status |
|---|---|
| qctividadesdeinfantilyprimaria.com | Available |
| wctividadesdeinfantilyprimaria.com | Available |
| zctividadesdeinfantilyprimaria.com | Available |
| xctividadesdeinfantilyprimaria.com | Available |
| axtividadesdeinfantilyprimaria.com | Available |
| Ehna.tv |
| Crmpiperun.com |
| Groupe-insa.fr |
| Shinyapps.io |
| Dade2.net |
| Mo7pro.com |
| Jestjs.io |
| Pexgle.com |
| 3651columbiast.com |
| Roofatlas.com |